1.92 Rating by CuteStat

vlr.co is 1 decade 3 years old. It is a domain having co extension. It has a global traffic rank of #2651232 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, vlr.co is SAFE to browse.

PageSpeed Score
66
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 181
Daily Pageviews: 362

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 2,560
Bing Indexed Pages: 2

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 2,651,232
Domain Authority: 15 ON 100

Web Server Information

Hosted IP Address:

96.125.161.206

Hosted Country:

United States of America US

Location Latitude:

29.7633

Location Longitude:

-95.3633

Websites Hosted on Same IP (i.e. 96.125.161.206)

Artikel-Schrijven.com

- artikel-schrijven.com

Artikel Schrijven Is Een Verzamelplaats Van Kwaliteits Artikelen. Artikel Schrijven Geeft Je Relevante Backlinks Voor Je Artikel En Een Hogere Ranking !

93,532 $ 88,560.00

Index of /

- onlinemarketingreviewsandtips.com
1,528,854 $ 480.00

Domain Information

Domain Registrar: Camelot 30, LLC
Registration Date: Aug 5, 2010, 12:00 AM 1 decade 3 years 8 months ago
Last Modified: Aug 9, 2012, 12:00 AM 1 decade 1 year 8 months ago
Expiration Date: Aug 4, 2013, 12:00 AM 1 decade 8 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns827.hostgator.com 192.185.224.58 United States of America United States of America
ns828.hostgator.com 192.185.224.59 United States of America United States of America

Similarly Ranked Websites

Welcome to Swindon Town Centre

- swindontowncentre.co.uk

Whether it's shopping, leisure or business services you're looking for, you can be sure to find it in the Swindon town centre.

2,651,238 $ 480.00

Saudi Center for Organ Transplantation | المركز السعودي لزراعة الأعضاء

- scot.org.sa

������ ������� ������ �������

2,651,241 $ 240.00


Home - RFV Basel

- rfv.ch

RFV Basel – Popförderung und Musiknetzwerk der Region Basel

2,651,250 $ 480.00

Soybean Meal Resource for Nutritionists, Feed Formulators, Producers

- soymeal.org

Soybean Meal Resource, the feed information clearinghouse for U.S. soybean meal. A comprehensive resource for feed manufacturers, professional nutritionists, feed formulators and livestock and poultry producers. Soybean Meal is the premier vegetable protein choice for livestock, poultry and aquaculture production.

2,651,251 $ 480.00